PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00175g11021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 133aa    MW: 15144.7 Da    PI: 10.5318
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00175g11021.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.66.8e-283180251
                              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                              rien + rqvtfskRrng+lKKA+ELSvLCda+v ++ifs++gk ye++s
  Peinf101Scf00175g11021.1 31 RIENATSRQVTFSKRRNGLLKKAFELSVLCDAQVGLVIFSPRGKQYEFAS 80
                              8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.3472282IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-382281IPR002100Transcription factor, MADS-box
CDDcd002658.08E-412496No hitNo description
PRINTSPR004042.7E-292444IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.23E-322499IPR002100Transcription factor, MADS-box
PfamPF003191.2E-253178IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-294459IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-295980IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
VIAKSSFSVI VYSIYYKGLK KMVRGKTQMR RIENATSRQV TFSKRRNGLL KKAFELSVLC  60
DAQVGLVIFS PRGKQYEFAS SSMQEIIERY KGHTKDKVQT ENQAGEQNLQ VISCLYVSSM  120
IDKQIVIIRI TVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A1e-182493271Myocyte-specific enhancer factor 2A
3mu6_B1e-182493271Myocyte-specific enhancer factor 2A
3mu6_C1e-182493271Myocyte-specific enhancer factor 2A
3mu6_D1e-182493271Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3352381e-142AF335238.1 Petunia x hybrida MADS-box transcription factor FBP20 (FBP20) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016500314.19e-55PREDICTED: MADS-box protein SOC1-like
RefseqXP_016500313.19e-55PREDICTED: MADS-box protein SOC1-like
RefseqXP_009796069.11e-54PREDICTED: MADS-box protein SOC1-like
RefseqXP_009796063.11e-54PREDICTED: MADS-box protein SOC1-like
SwissprotO646458e-44SOC1_ARATH; MADS-box protein SOC1
TrEMBLQ9ATE91e-58Q9ATE9_PETHY; MADS-box transcription factor FBP20
STRINGPGSC0003DMT4000265765e-45(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.15e-45AGAMOUS-like 20